DPCstruct | MC6068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 181 ± 31 aa |
| Standard deviation of domain lengths | 31.33 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7SH64 | 2-136 | PPDSGSTRLFSVCAKLDCSSFTKVTATALVVRGHIALYVDNAAPSPGLPQTDLDSIADMFNSRLYAIDTTAFGRESDIDDNQVVAVL… |
| A0A2V7Q2W0 | 45-267 | AYAAADPTQTAGCAVFPANPLGSGIEYVVVPQSASSIPDDSQGFKLGGKPLPAPPLPGAPLGGPSVAQQFDLRLRLAEREFAAQLPV… |
| A0A1F9M502 | 27-194 | None |
| A0A661JIF3 | 3-208 | None |
| A0A5D0MHM0 | 29-233 | None |
| A0A1B9AYS4 | 120-278 | None |
| A0A2N1U4G1 | 2-202 | None |
| A0A7X7SIA4 | 301-485 | None |
| A0A2V7QJD6 | 1-195 | None |
| A0A847LL54 | 65-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.