DPCstruct | MC60678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 188 ± 27 aa |
| Standard deviation of domain lengths | 27.32 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14222 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q2XWM0 | 1-188 | MPISVDPESKPGEYVLKSLFAAFATMSEHKIRVIMAEPLEKPLSKSLQRGEDLQFDQLMSTMSSLAEYCLPSILRTLFDWYKRQVGL… |
| A0A0R3R956 | 2-136 | ERNINKALQIGEDTYVENLLRVLNTLCEHCLPSVLATLVSWYEKQLDRFKELSEKTAKSDEQRLAINYLFCIVLIEVLPQLHFFPTI… |
| A0A044V8Y5 | 34-220 | None |
| A0A818C286 | 1-216 | None |
| A0A7J5ZMY2 | 1-192 | None |
| M5G3Z1 | 22-212 | None |
| B8P2M7 | 272-486 | None |
| A0A0L8GD37 | 32-210 | None |
| A0A423WPT1 | 80-319 | None |
| A0A7F8QC99 | 2-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.