DPCstruct | MC6067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 309 ± 42 aa |
| Standard deviation of domain lengths | 42.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A9ARC8 | 29-349 | IFGIVLIFCTGLRSFQWNDTSVYAQSFQYYTNDLSNYSILDTGSGYSEKGFYFLSSVIKTFTSSYTIYFLIIAALTFYFLNSSLRTY… |
| A0A653KBP1 | 6-322 | NYDCLVNNKCYSGFVEFEVGYEFLVKTIGQLGFQPLLIFIAFLNLIFISSFAKKFENSALIVLFIMCVFLWSLYMEAIRQSIAISLV… |
| A0A6L9MJL4 | 70-415 | None |
| A0A1Y4AVA7 | 370-688 | None |
| A0A3G9FU46 | 8-314 | None |
| A0A6G7ZB66 | 2-367 | None |
| A0A5M8P1X5 | 16-340 | None |
| A0A379F0B1 | 7-248 | None |
| A0A443IAJ9 | 20-385 | None |
| A0A849JB63 | 2-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.