DPCstruct | MC60656
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 87 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 62.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0090 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2N3A0 | 2-81 | ILFEEHNDILDLFEKFSSLRTKEEQQESLELAEHASMVMNTLHNAISSLDNPDAFFSFVEQVGASHRRIPGFNKDYFWML |
| A0A5E4N9Y5 | 121-204 | GVYMFIKLFEEHQELLQLFTKFGELKTRDAQANSMELAEHANKVMTTLDEGIKELDDLDSFFQYLTQVGATHKNIPGFNPDYFW |
| A0A7E4RX60 | 1-88 | None |
| A0A084WI00 | 59-145 | None |
| A0A6A0GYF4 | 1-94 | None |
| A0A7R8UXR4 | 3-97 | None |
| A0A7J6ZTQ5 | 6-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.