DPCstruct | MC60655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 498 ± 77 aa |
| Standard deviation of domain lengths | 77.44 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4VYP5 | 8-440 | QYCADIIAILTIVASFLPSLIASPVMLFSVRIHESVALPIHRRADLLLKVAALKCAPIENLARVFQKGFDSAVKRNSYPESVTSIES… |
| A0A0P4W3W7 | 5-510 | RQPQYCADIIAILTIVASFLPSLIASPVMLFSVRIHESVALPIHRRADLLLKVAALKCAPIENLARVFQKGFDSAVKRNSYPESVTS… |
| A0A7I8VWI9 | 503-1059 | None |
| A0A7J7XZA4 | 2-468 | None |
| A0A835G4D7 | 714-1226 | None |
| A0A1L8I1Q9 | 576-1209 | None |
| V4A8I0 | 348-817 | None |
| A0A6P6DTM5 | 74-628 | None |
| A0A2J7PY60 | 2-415 | None |
| A0A3P9C8Y7 | 176-808 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.