DPCstruct | MC60653
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 239 ± 51 aa |
| Standard deviation of domain lengths | 51.32 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.30 |
| Pfam Score | 86.67 |
| Assigned Pfam label(s) | CL0020- PF04836- CL0263- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4VZR5 | 28-234 | IAQTSKDNDPEWFKGLDTRFKTKEAVMRNSAETRMRSYLQHTEGELLAKNLPPDSPQKNAILFFKEKLHKSKYNASYFDRSAVLETE… |
| A0A2C9M2N6 | 49-294 | DLVKVVEGLQLLISSIKPEGIKEITQLLKKEESYEKLEMFSQLKEASLINIDAEKRQDDEDWFQGIDKKYKTKTAYMKYLAQRRIRS… |
| A0A3S1ATL1 | 1-182 | None |
| T1GHI0 | 7-274 | None |
| H0YWX9 | 340-624 | None |
| A0A6A4V661 | 50-263 | None |
| K1P4N7 | 86-329 | None |
| A0A7J7IRM2 | 1-177 | None |
| A0A6J0W2Z5 | 93-346 | None |
| A0A0N7ZBG4 | 75-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.