DPCstruct | MC60645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 9.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 35.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0094 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820NVV6 | 1-88 | PLVYVDPIHANLTTLYVELINDSLTEFVYQAQLGGLDYELYDCNDSIQLNISGFNHKIKELLNIIIDHMINIKIEVEQFEIIKEKVIQ |
| A0A1D6GA94 | 104-183 | IDFHCPLSSHSSEAVVATELFVDLLVDYLNAYAYDAQIAGLFYSIYLTSAGFQVSLGGYNDKMRALLNAILVQIASFEVK |
| A0A4Q7JHE8 | 2-86 | None |
| W9NSD8 | 74-154 | None |
| A0A0R3TAL8 | 162-241 | None |
| A0A0N4VYN5 | 1-86 | None |
| A0A2W1BC75 | 233-312 | None |
| A0A0J9WUY4 | 231-318 | None |
| A0A3M7B193 | 214-290 | None |
| A0A0R3VYY2 | 55-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.