DPCstruct | MC60641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 94 ± 17 aa |
| Standard deviation of domain lengths | 16.58 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.35 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0226- PF03820 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V3Z1X3 | 29-98 | HPCRCNGTLGVVDLSSLATANNEPRFKDVEELSGTYLYSFSPCTAFNEGGCVGVSGCKTDNSSFYTIGKP |
| A0A820MAJ0 | 1-87 | MMISWLTIFTYSTLLSSLIIADDPCRYVHPTKGVMDLTSLGRTDGQPAYPDKLPPTGSGYKYSYNPCKPFTEQPNCIGVAVCQISMD |
| A0A2G8L965 | 26-151 | None |
| A0A3S1B6R9 | 9-114 | None |
| A0A818XKV1 | 3-84 | None |
| A0A813M2V3 | 1-120 | None |
| A0A818QFI6 | 1-93 | None |
| A0A813ZAD3 | 23-144 | None |
| A0A814FR22 | 20-99 | None |
| A0A6P8HYX4 | 5-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.