DPCstruct | MC6064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 145 ± 22 aa |
| Standard deviation of domain lengths | 22.16 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 15.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13274 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6PWW4 | 2-143 | IHRIAEAMLTFGPLTTDKLQKLCYFAYAWYLTFYGERLFREKFEAGEQGPVCPELAKKYLEYGQGLIPKSDKKLGVIINDEELKEYL… |
| A0A662SJH0 | 29-178 | SDPSPGGGPVRELILYLVRRFREREGREITLTRLVKLLYLVDLRLRERGLPGLGVRWVRWYYGPFSRDVVREVEALVEGGELREEFL… |
| A0A7V9IF76 | 91-252 | None |
| R9MD50 | 35-193 | None |
| A0A447G2P0 | 5-135 | None |
| A0A447G3E1 | 1-129 | None |
| A0A447G4R1 | 7-137 | None |
| A0A447G4W2 | 10-150 | None |
| A0A525WFD2 | 6-164 | None |
| A0A516H4P5 | 5-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.