DPCstruct | MC60618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 152 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077ZKE5 | 382-537 | TPLRAWAAGNVTVYLKGLSVPVILNITSGETDTTTLSQEIDSRLDLRIPRRGPASPVVSIPSEKIALHDATLQAFLDGVPPDDPAIR… |
| G2JAR9 | 1-143 | MEGDVAVFLKDLPYPVVIKMVAGQRETDYRLDLRIPKTGPNAQPAITTETAIGLPSATLQSLLEGIEPPQAKPIRIRNAPANMKAWL… |
| A0A149SKX8 | 1-160 | None |
| A0A3M3Q311 | 47-197 | None |
| A0A0F9V9Q4 | 189-338 | None |
| A0A2E2TYZ8 | 155-297 | None |
| A0A2T4MX42 | 181-323 | None |
| A0A2W5FL86 | 2-176 | None |
| A0A6A6D549 | 559-709 | None |
| A0A3D3IWL9 | 208-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.