DPCstruct | MC60610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 93 ± 5 aa |
| Standard deviation of domain lengths | 5.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 84.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19788 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838NBE3 | 3-90 | EFSIFSGNIVTNSGSEKLNKRLNGIKSLSDGDLKKQYIDVLSNGELSAKGGAGLGFLTIALKSGNSIDFEFEALNKEYSLFSLQSKVL |
| A0A3N5ECM7 | 34-132 | TIHIQNNDLYFKCTTVNRILSEHQNVLIKNCREINSSTKEDLKKRKEKFRKESTILDTGAHIGLIAVCLYSENQFEFDVTDNPENSA… |
| A0A348PL35 | 102-195 | None |
| A0A2E7TTE9 | 44-143 | None |
| A0A1I2CQ56 | 107-193 | None |
| A0A7T9KKA1 | 96-182 | None |
| A0A350JF73 | 129-215 | None |
| A0A3C1PIF7 | 146-242 | None |
| M3HVX4 | 387-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.