DPCstruct | MC6061
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 67 ± 5 aa |
| Standard deviation of domain lengths | 5.32 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 25.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10133 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2P5P8 | 1-56 | MILEHDGSRELLMEEVVRILVEDDKIQLVGLLGERKEVKGRIKEVNLNRHEVIISD |
| A0A662S9K3 | 1-63 | MCEFTVILYEDGKENQVARDIIRTTYKDGELILIDILGDSVSVGGALIREVNVDSEVLKVHRH |
| A0A7C1J8S5 | 1-61 | None |
| A0A0M2UU93 | 1-57 | None |
| A0A7C7VEB4 | 77-155 | None |
| A0A0S8ERP8 | 1-65 | None |
| A0A7J3NRR1 | 18-91 | None |
| A0A1G3XSU6 | 1-65 | None |
| A0A7C4D9C0 | 80-148 | None |
| A0A2M7JTS5 | 25-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.