DPCstruct | MC606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 105 ± 7 aa |
| Standard deviation of domain lengths | 6.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5Y709 | 4-108 | VSVSKIFNETPGSWGLRGDPCFWDDLKRHFENTLLPYSLDAFEAEVKRFFKDIAGKTLSGDSVYVEKYARGGMSNGMVSCSFWLEQG… |
| A0A7X7CHD4 | 1-94 | MKVSEIFNDEPSQWGLRGDPYLWREMKELLKDTDMPCSIEELQILIEETYKKATGHPLTYQGHFLLDRFQHGGMSSGFISPEFWTAK… |
| V6AHU6 | 62-172 | None |
| A0A3A4S4S3 | 331-429 | None |
| A0A1Q2D0Z7 | 42-151 | None |
| A0A4Q5C7X7 | 78-182 | None |
| A0A543MP30 | 68-185 | None |
| A0A7X8UAI6 | 116-214 | None |
| A0A7K0PAH0 | 94-201 | None |
| A0A6V8I9I8 | 212-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.