DPCstruct | MC60582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 164 ± 14 aa |
| Standard deviation of domain lengths | 13.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 34.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813KA63 | 70-221 | VCCKNECEDYLSEIEAAVGAPTATPELVLAVVGNITTSLDDECAKIPASLMTQLFDIANSHDGSISLHGRLFAQWLHYVFPQDCPFP… |
| A0A7S2JAZ8 | 25-178 | PAHLDANLRTQLAQVAASSGGKVPLHGRLFAQWLHYVFPRECPFPHKVGSTVSMTPTEYGDNFIASKDEMHSHASNASSTDAMATMG… |
| A0A813H2F8 | 1-146 | None |
| A0A812RIL4 | 221-373 | None |
| A0A1Q9EJN2 | 827-1006 | None |
| A0A812KES5 | 353-514 | None |
| A0A7S2J5E5 | 1-152 | None |
| A0A812KZH7 | 102-271 | None |
| A0A812NQU6 | 382-557 | None |
| A0A812HNK5 | 74-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.