DPCstruct | MC60581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 252 ± 36 aa |
| Standard deviation of domain lengths | 36.20 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 23.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2J8F7 | 10-214 | PMKTVLEENRGTSLYYYFGNLNQAINVDYEISRHLPFAMRKAQRLTEALTYQAEEPKVTYKWDGGEITTVINNCMAADEPYCFTNGW… |
| A0A812R4V2 | 8-253 | QIHAKEHFCGHLLVDRCDPQAYVWCNNNCRLHTHGPDCHRPLPDVMAENPGIDGYCYFNATAGWLVYEGPTSDFEAHAARTIQLFRD… |
| A0A1Q9DLZ2 | 6-289 | None |
| A0A1Q9DB02 | 578-820 | None |
| A0A1Q9DB14 | 715-995 | None |
| A0A7S2B4I7 | 26-314 | None |
| A0A813BP59 | 163-454 | None |
| A0A7S0AK62 | 16-294 | None |
| A0A812J0M8 | 84-302 | None |
| A0A812LZA8 | 60-301 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.