DPCstruct | MC60575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 255 ± 47 aa |
| Standard deviation of domain lengths | 46.99 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 19.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M7UKL7 | 18-279 | PITESTSTSPLRLTLSRAQVFACIYMFELGTFNLDPEGSKEVFVISSGNSIFVTSPLLCDPYEKPTGVEIQRVPGNIVDPELSLLIP… |
| A0A1C3VJQ9 | 3-221 | ILRMAEALFGLPSGEASYGFFTGEIVILPCVVGDDIGTAPKGLLSWRQDGISGLEDAGPMRFRYAQSDYFAQTKSQIGLVSAASDQG… |
| A0A1M3TVX2 | 370-544 | None |
| A0A6A5X4W3 | 402-645 | None |
| A0A0D8JVW7 | 14-226 | None |
| A0A2J6Q1F0 | 710-998 | None |
| A0A1L7UM48 | 495-729 | None |
| A0A0D1ZLQ4 | 846-1118 | None |
| X0GLN2 | 82-344 | None |
| Q5B0I3 | 625-865 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.