DPCstruct | MC60572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 162 ± 24 aa |
| Standard deviation of domain lengths | 24.49 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.18 |
| Pfam Score | 96.08 |
| Assigned Pfam label(s) | CL0274- PF03747- PF05907- PF00375- PF02792 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2LMC9 | 30-201 | FRHGISASILTQPQKLGLQLKCDLDNVTNLRASGDDFRWYVQAKCTNCGQEFPDFIYVCPAERVALKDSRGDANLIIRCKFCNRVGN… |
| A0A1V2L672 | 2-123 | VFHLNLKANLQGLTDLAPVDTDDSPFEYTFLIQCTSCREQHDKEITINRLEQHDLPGSRGEANFVFKCKSCGHLANASITRTSKNYT… |
| A0A158QYZ7 | 274-437 | None |
| I2H5B8 | 2-181 | None |
| A0A395J474 | 74-266 | None |
| A0A7S3PPZ7 | 117-299 | None |
| U6KLN9 | 16-173 | None |
| A0A4Q7JWX8 | 753-940 | None |
| U6JXX2 | 1-107 | None |
| A0A843UL41 | 4-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.