DPCstruct | MC60570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 123 ± 13 aa |
| Standard deviation of domain lengths | 12.95 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9AT01 | 21-146 | LCIAGTNYPGGAAIARLHRLAKDEPYVNVHIAVLAAQTGVSRFTQINPHWRYNKTENLTSGSDEMMAFTHLLIEAKSKYSSNLKPYA… |
| A0A4S2LHP4 | 68-204 | NLLGTTVLVLVSMKNYPGGEALNRLNHLPQLAERRDTHVHICNLAAQTGVTRFLEQHSHWIYNKTEHIENDFRLLELGQFTHLISEI… |
| A0A368FED9 | 19-142 | None |
| A0A0K8T306 | 134-266 | None |
| A0A854QFY5 | 99-266 | None |
| A0A7R9HVQ9 | 21-146 | None |
| A0A5B6VKD7 | 17-124 | None |
| D3B0B5 | 402-507 | None |
| A0A6A5D2G6 | 196-312 | None |
| A0A3P6NW97 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.