DPCstruct | MC6057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 129 ± 17 aa |
| Standard deviation of domain lengths | 16.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19804 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5RVK8 | 292-428 | KVDSNSTTENKNQANSDMNVNQIANGDYSSIQGTWKNSNGNTITVSGSTITENGNVITPIQHVGKDYLSITGTLNLLGQGKASPPNL… |
| A0A380K0N4 | 30-152 | QTSQFDFNALTQSDFSSLAGTWMDANGYTFEFSPQGIIDNKLILSALVYDENGEAISNVYTESGGGFILHYYAAGSQIPSWHFGITE… |
| A0A2U1DBD3 | 46-196 | None |
| A0A4T2GR21 | 45-182 | None |
| E3CQQ3 | 161-280 | None |
| A0A150NM45 | 57-191 | None |
| E1LSR2 | 1-117 | None |
| A0A3E5D389 | 329-453 | None |
| T0U3P5 | 1-108 | None |
| A0A0R1HII2 | 339-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.