DPCstruct | MC60561
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 157 ± 24 aa |
| Standard deviation of domain lengths | 24.49 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 19.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03706 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2MK32 | 4-161 | KVILGILISVILVYLSVRGINLQDVLNDLKQIQLSYVIFFLILVILMQYLRSYRWGVILQPMEKIDQVSLFSVTSVGFLAIAAIPAR… |
| X1AGV2 | 3-138 | IIGILLLAYLILSIGTDEIASTFLKISPVYILIAASLTIPRVLIRNYAWQLILRKQKINVSFFKSLKIFLIGYFYGSITPGYIGQFM… |
| A0A2K1FU32 | 10-169 | None |
| A0A0P6X674 | 11-149 | None |
| A0A537TGF6 | 26-205 | None |
| X1QBZ3 | 18-164 | None |
| A0A381KMN1 | 3-196 | None |
| C2FVZ1 | 1-143 | None |
| A0A536HVK6 | 5-211 | None |
| A0A535XSQ0 | 330-517 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.