DPCstruct | MC60550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 162 ± 17 aa |
| Standard deviation of domain lengths | 16.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8BF68 | 1-163 | MHRELFPRTTGDTFDPLSPATIAADVTIGFVLQLDRAARMVAQHAVNPAAPGLENVIDRLTAATFDAPTATGYEAAVRRAEERVLVD… |
| A0A7Y2FCF6 | 401-586 | KGLFKTLDAETIAIPADKLALFPPRAIGYSKTRESFNGKTGVSFDALSAAETAADMTLGFLLHPERASRLIQQKSLDVKQLGLADLF… |
| A0A1Z3HSR4 | 42-200 | None |
| A0A6L8FAL8 | 112-241 | None |
| A0A7W9SS19 | 990-1146 | None |
| A0A7Y1Z6D5 | 1-133 | None |
| A0A842YKV2 | 23-193 | None |
| W4PDI5 | 117-311 | None |
| A0A3D4PEA0 | 139-310 | None |
| A0A7Y1ZQK5 | 370-519 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.