DPCstruct | MC60548
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 534 ± 125 aa |
| Standard deviation of domain lengths | 124.90 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 74.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20253 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A7A3D9 | 79-618 | AFHLLLSDLDKLRTEVERTWEGYKQGMYDLVVASITTNTAVDLARSLEQEYKDLFARRGGTDRMLAMFYQAQCAAANTTESFKDRPG… |
| A0A194X3Y6 | 2-388 | IETKQIPIWLTFATTVFLDINQTLRGRVSIAFDELQVVANHVKNTLDGYFEFSKSIPAPRTWPKSYEEMLREFREGVAETILKDVVF… |
| A0A2T4AXD4 | 7-493 | None |
| A0A1Y6LXP8 | 1-381 | None |
| A0A178ASI8 | 13-477 | None |
| A0A4Q4SAS9 | 4-651 | None |
| A0A1B7XQT7 | 48-442 | None |
| A0A1Y2HJP5 | 5-722 | None |
| A0A177UZC0 | 207-911 | None |
| A0A177VVX0 | 179-911 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.