DPCstruct | MC60538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 153 |
|---|---|
| Mean domain length (aa) | 315 ± 63 aa |
| Standard deviation of domain lengths | 62.94 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 15.10 |
| Pfam Score | 92.81 |
| Assigned Pfam label(s) | CL0137- CL0016- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T3ASF0 | 33-384 | RARPAYSKPTSYISDIEQRLELLRDIRKKWEKAAVQMQFTAVLWSALMVIPLEQLRDIRDNPFALSIIKSVIPDTTMLLKVFLAKPL… |
| K3V9Q2 | 308-671 | ILLQFLLSKMVDISALLHSSSSLAHPVSSLNTFRPRMNQLSKITVTVQRLYPDFQFRVEHIAVILLADLKHFEKGYALSEEVDPGTL… |
| A0A1J7ISN1 | 1-291 | None |
| F2RSE7 | 19-290 | None |
| A0A366S4Y9 | 209-539 | None |
| A0A0J6XWK4 | 4-224 | None |
| A0A0C2YIQ5 | 1-365 | None |
| A0A3D8SWH5 | 7-369 | None |
| A0A1J7J2R4 | 118-452 | None |
| A0A0F8A688 | 17-323 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.