DPCstruct | MC60533
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 200 ± 38 aa |
| Standard deviation of domain lengths | 38.38 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 65.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4XPF8 | 7-193 | DQRFQKVHNDPRFARNSKRKNKLEIDRRFAAALKDERFQSVQGKYDKYGRRIEKKENELKKFYRLEEEEEEKEDAMAKAPSTTSSDD… |
| A0A1Y1KKF1 | 1-188 | MDDQRFAHVESDPKFRRIPKSERKVKIDKRFKSMFKDKQFKVKYTVDKRGRPVNHTSTENLKRYYELDSDASSIESDSEVGHNELDV… |
| A0A819HCA5 | 6-166 | None |
| A0A453BD23 | 91-266 | None |
| A0A482SRG8 | 14-233 | None |
| F1KT92 | 7-210 | None |
| B4GTM7 | 28-271 | None |
| Q941E0 | 27-255 | None |
| A0A0D3GRX2 | 94-253 | None |
| A0A2N6P2H3 | 54-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.