DPCstruct | MC60532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1932 |
|---|---|
| Mean domain length (aa) | 135 ± 25 aa |
| Standard deviation of domain lengths | 25.01 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 73.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.80 |
| Pfam Score | 88.63 |
| Assigned Pfam label(s) | CL0023- CL0129- PF18701- CL0027- PF15550 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4XP77 | 27-161 | DALSRRPDYERSYLYDRIRLAYQEDENNTPLVHFLSDGKDAKVDRLLPRQRAQFHRYELAEGLLHYRVGPTDPPRVVVPNDEYLKYD… |
| A0A0C3DMQ3 | 11-147 | PNNVRNAFQDYIHQPEYSNRARIPYANWRQMHIFLDTPDQKPENSTESNLKHRALIEFELISNRLYRQGDKKYPDPRYVVPESEAFD… |
| A0A2J8ADW3 | 241-342 | None |
| A0A3B4G353 | 33-115 | None |
| A0A2G8L6F4 | 316-459 | None |
| A0A2G8L6I7 | 155-297 | None |
| A0A2G8L8Q5 | 164-297 | None |
| A0A2G8LID4 | 405-520 | None |
| A0A6D2HEV7 | 141-281 | None |
| A0A6D2I046 | 2-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.