DPCstruct | MC60531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 60 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 35.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G2CCW4 | 271-318 | GKTVVFGHDAKRRLQVTPFAIGLDSGCVYGGQLTGITFPGRQLTSVPG |
| A0A2P4XNS9 | 2-64 | WAKVWTGPRHVYFGHAASAGLQQENFATGLDTGCCYGKRLTACIIPSNELVHVDAKEQYEVPS |
| A0A7Y5PXE1 | 14-81 | None |
| A0A239BZD0 | 1-56 | None |
| A0A354W4X0 | 49-100 | None |
| A0A1A9UKM1 | 190-243 | None |
| A0A2W5DW34 | 20-77 | None |
| A0A0B8P6M3 | 22-76 | None |
| A0A3L7UUZ9 | 368-429 | None |
| I1DXU5 | 11-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.