DPCstruct | MC6053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 94 ± 5 aa |
| Standard deviation of domain lengths | 4.91 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0AYE6 | 1-92 | MEFRYSTKIDPSTYDTEGLCEGIDLRKHNFTFLEDRGAIRAQADWNKYVSSVADYRGALGPEYSLISVGIPECLPDRLEIVSYANEF… |
| A0A1Y1MMA9 | 1-99 | MEFRYSEIVIPHLYQTHGLANGIPLRRHRNSSNEMKGALRAQNDWHKHVMPIENYHGGLGEDFSFIRVTVPECLPERLEIISYANEY… |
| A0A366SAN0 | 7-96 | None |
| A0A5N6FD33 | 1-97 | None |
| A0A319E3G0 | 6-101 | None |
| A0A0L0NHD9 | 1-93 | None |
| A0A5N6UJ65 | 9-115 | None |
| A0A2G7FF17 | 24-112 | None |
| A0A7C8MS40 | 1-94 | None |
| A0A1S1VSH4 | 6-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.