DPCstruct | MC60526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 106 ± 17 aa |
| Standard deviation of domain lengths | 16.97 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225WL47 | 2-73 | VRSSFSFDDDKQLVQLARAYEDAGSRVQWSNVTHKMRRTGHTASALKQRLRALMRTHGNRISSFPPSFFTSV |
| A0A2P4X4Z1 | 5-105 | SFCFDDDKELVQLARNYEQDGARISWRDVAHRMRRTRHNANALHQRLKSLMRTHGSRLAQFPRNYFTPVQRPRAVQSVVQAAPSRIP… |
| A0A6A3RYC2 | 1-114 | None |
| W2Y1W9 | 2-117 | None |
| A0A6A3NI55 | 1-94 | None |
| A0A6G0S008 | 1-123 | None |
| D0NFD7 | 1-103 | None |
| A0A080Z0V2 | 1-125 | None |
| D0NL16 | 10-112 | None |
| A0A6A3JYA1 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.