DPCstruct | MC6052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 179 ± 26 aa |
| Standard deviation of domain lengths | 25.60 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14750 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R2CU99 | 16-156 | VQKLIDNLGHNEEVDNAICEFLHSYWIENFMLIKLVHTQGYSKKLLSITVNKIGSLICTWDFILDLVQNGTSKQQRFALQLAGHLSY… |
| A0A1Y1MBH2 | 3-185 | LETCLETKEDSETPGQLLALQEVRSLVCSYLHQVFIVDPSLAKLIHFQGYPSELLPVTVRGIPSAHICLDSLPELMQQPSVTKQIFA… |
| E5QCH1 | 953-1153 | None |
| A0A564YHH6 | 261-494 | None |
| A0A817R4K0 | 1-151 | None |
| E9FQN4 | 53-206 | None |
| A0A7R9B1S8 | 231-418 | None |
| A0A5K3FK48 | 722-914 | None |
| A0A3P7EFB2 | 404-558 | None |
| U9SL78 | 500-666 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.