DPCstruct | MC60515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 174 ± 25 aa |
| Standard deviation of domain lengths | 25.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 47.26 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0509- CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146L8J6 | 4-160 | PVVTQPKIYHLDVSAMYPNIILTNRLQPYAMVSSSTCGACEYYSPDNSNRCQRVMEWAWRGKVYNASEGEVNRIRLQLREKGVGGWS… |
| A0A0M3JJM3 | 2-116 | ACIYNTPDAKCKRVMRWEWRGEVVPATKGEYERIFQQLENEKFGKPPKPFHSLDREERASIEKKRVQDYCRRAYGKTHMTRNEFRYT… |
| A0A817RG99 | 148-337 | None |
| A0A813A5L1 | 94-270 | None |
| A0A820TB41 | 27-191 | None |
| A0A504Z1J4 | 55-217 | None |
| A0A0M0K3P2 | 398-566 | None |
| A0A812XSM2 | 449-604 | None |
| A0A287F516 | 169-344 | None |
| A0A7N6A2D8 | 263-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.