DPCstruct | MC60514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 209 ± 36 aa |
| Standard deviation of domain lengths | 35.95 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146KZP7 | 7-191 | AESDSEDEPLLSRVGDIPLEWYDSEDHMGYDIYGNPIKHLDRGDGIDAFLRRADDPNAMRTIFDPLNNCNIILTDEELNMIHRLRHG… |
| A0A4P9YYY2 | 183-334 | SDSDTEQFGHNTVGKIPMEWYKDMPHIGYDLDGKPIMKSAVADELDKFLANVDDPNTWKTVRDELEQQDVVLSPEELQVIQRMQQGH… |
| A0A6U0GD28 | 3-153 | None |
| A0A7J7INA8 | 1-149 | None |
| A0A6A6KXX5 | 106-271 | None |
| J9EZ85 | 5-245 | None |
| M4CL06 | 631-863 | None |
| A0A1Y2FD38 | 199-388 | None |
| A0A6F9AAL6 | 51-263 | None |
| A0A2C6KNI0 | 340-558 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.