DPCstruct | MC60512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 10.21 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 44.17 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0193- CL0061- PF14805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M1HZ49 | 1-84 | ITPANVDTVTREAVNQVIGLLDSGALRVAEKIDGQWVTHQWLKKAVLLSFRINDNKVMDGAETRYYDKVPMKFADYDEARFQKE |
| A0A848QAK2 | 1-80 | MQAIETLIDDAFERRNALTQAEIDTHLRPAIDQVLDLLESGERRVAEPDGRGGWTVNQWIKKAVLLYFRINDNRVVDGGP |
| A0A6A5LCB9 | 3-79 | None |
| A0A6A5L6U4 | 6-92 | None |
| A0A4Q5ZQC7 | 5-88 | None |
| A0A357NRD9 | 82-183 | None |
| A0A448MPD8 | 3-72 | None |
| A0A2X1Q1T5 | 1-64 | None |
| A6GU21 | 1-70 | None |
| A0A7J7AGT0 | 387-463 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.