DPCstruct | MC6051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 302 ± 58 aa |
| Standard deviation of domain lengths | 58.29 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1M974 | 8-301 | TLDICLYKIFNQIMMISHESGEFNWDQTKSLYQDLLVVFDKVVLPTYNIHHVPFVMFFLCSLKPTIAEAFLNFLWRKVCNPNVPSIH… |
| E4WQ61 | 53-321 | RDTFDRIMLRFFQFIETSVASDDELGQKNNMLMLLREMVAIFGKVLLPQPNTTTVQYVYFYLLSLKGAFSTSFCDWMLKRIRNKSES… |
| A0DD74 | 7-369 | None |
| A0A1Q2YDN8 | 182-548 | None |
| A0A1Y2CWU4 | 457-783 | None |
| A0A397Z870 | 6-270 | None |
| H2NQM3 | 3-224 | None |
| H2NRY3 | 39-254 | None |
| V8N8X5 | 135-450 | None |
| K7HUZ8 | 14-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.