DPCstruct | MC60508
Metacluster Properties and Pfam Annotations
| Number of structural domains | 144 |
|---|---|
| Mean domain length (aa) | 221 ± 44 aa |
| Standard deviation of domain lengths | 44.20 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.85 |
| Pfam Score | 79.70 |
| Assigned Pfam label(s) | CL0039- CL0258- PF03485- CL0278 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538CAT8 | 320-568 | RSGTLMTGPIEDLRAAVAAAASEIGEASSAPTLERPRQAGHGDFSTNAAMLLAKSAGAPPRDIAERLAASLDVRLGDDLASYEVAGP… |
| A0A2X2BK86 | 4-175 | QAFLSEKISMAMSAAGAPADSEPLVRQSAKVQFGDYQANGVMGAAKKMGIPPRQLAEKILEHLDITDIADKVEIAGPGFINIFLSPV… |
| A0A536IGV7 | 69-234 | None |
| S0ET34 | 10-290 | None |
| A0A7V5J1R8 | 5-169 | None |
| A0A835IIR0 | 4-157 | None |
| A0A376U9F2 | 9-252 | None |
| A0A7V3AUS1 | 1-135 | None |
| T2JB64 | 1-166 | None |
| A0A2W6S2D3 | 5-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.