DPCstruct | MC6050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 232 ± 21 aa |
| Standard deviation of domain lengths | 20.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 48.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1K0K2 | 65-268 | ERKGDCIVQPASDHSSLKEYEERLKQQQNEACRRENYLLLRLTRKEQEITEYKNRIQAMREELIPSDSRLNSTLLDPALNLMFEKMK… |
| A0A1Y1M691 | 17-214 | ALVIAGDIADLRQTLEKAQLQLSESQQREKVLVRRLAAKEQESQDLVCQVNELKSAQIPTSSSLRSTLLDPAVNSFLQLLRNELQTT… |
| E9G607 | 38-272 | None |
| A0A6A4WE57 | 2-244 | None |
| A0A499FUW6 | 248-501 | None |
| A0A2G8LE24 | 3-258 | None |
| A0A1J1IIG4 | 1-236 | None |
| A0A7J7AEB9 | 91-361 | None |
| A0A2B4SZ61 | 64-299 | None |
| A0A4Y7M9Z5 | 245-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.