DPCstruct | MC605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 118 ± 22 aa |
| Standard deviation of domain lengths | 21.66 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 93.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6D0LZ04 | 37-147 | NQSGTLFEGIERWAERKALLSHEDVKARAWKTLKWQIANGIQFVRTHVDVSDPTLTALKAMLEVKQEVAPWVTLQIVAFPQEGILSY… |
| A0A7X7AQD9 | 29-121 | YTDEDVIERAGLVVETAIKNATLAMRTHVDIDTVGGLKPLKGALALREKYKDVMTMQLVAFPQEGIIKDPGCDKLVDEAMQMGCDIV… |
| A0A3E1E0I8 | 166-301 | None |
| R9P7M7 | 144-288 | None |
| K2GEQ3 | 18-144 | None |
| H0ERR2 | 5-123 | None |
| A0A5N6ET42 | 568-684 | None |
| A0A133V3F5 | 8-109 | None |
| A0A4P0XYM2 | 482-594 | None |
| A0A377DHF1 | 113-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.