DPCstruct | MC60497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 124 ± 20 aa |
| Standard deviation of domain lengths | 20.17 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0197 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E2Y7L8 | 609-711 | DEINSMGNLETIPPYTFNGKGYPAGRIILGTHGLKKPHILEYLQAQEVQDPLLLDTDWLAIGHVDEFIQFLPSNNSLGWVMLFPDPQ… |
| A0A811ZSM2 | 254-371 | TFHSFGNLEVSPPVTVGRKKYPLGRILIGSGGYPSKESQEMHQAVQDFLSAQQVQAPVKLYSDWLFVGHVDEFLSFVPAPKKGFQLL… |
| A0A7Y4P133 | 136-276 | None |
| A0A1R0KGI3 | 459-566 | None |
| N4XHF1 | 236-358 | None |
| W6YJ59 | 222-365 | None |
| A0A6P9B1T1 | 106-224 | None |
| A0A0N9HSN4 | 207-306 | None |
| A0A646KRV3 | 289-440 | None |
| A0A0B4G4U8 | 343-443 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.