DPCstruct | MC60495
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 415 ± 41 aa |
| Standard deviation of domain lengths | 41.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 19.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02764 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B4GW91 | 4-454 | RQELLLCDFDFEDHEPVEGLDGERPITTDEEVLVTPERINIAEQAERVSVQEFEEATAEGILKIPNSWVKNGINSFTKAREKLGYKR… |
| A0A0B4H2M0 | 2-390 | DDCVLEPPETLHNQDEAPTTVETAEDGELMAVAKERSKESFDNLLQEFNYGSVVKQDQLYNELNARLPKFSTPRPEKIARLTTKIGE… |
| A0A167GAX3 | 582-1025 | None |
| A0A367LCI5 | 100-506 | None |
| A0A2C6A7Z5 | 730-1127 | None |
| A0A2C6A9P0 | 2-361 | None |
| A0A2C6ABF7 | 2-398 | None |
| A0A2C6AI88 | 15-431 | None |
| T5AJD8 | 159-598 | None |
| A0A162ICW7 | 278-677 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.