DPCstruct | MC60490
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 61 ± 3 aa |
| Standard deviation of domain lengths | 3.36 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 54.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9Y4G7 | 7-68 | DSIVLSGSPGYIKLLDAFNSYALVKELQEALDFPAAASFEHASPAGTAVGVELTETEKTGSM |
| A0A7U9D9B9 | 27-88 | PITIINGNPGYINLLDALNGWQLVKELKNATGLPSAASFKHVSPSGVGVAVKLSEVLKKAYF |
| A0A0D8XZ16 | 95-156 | None |
| A0A0C9XIX1 | 115-173 | None |
| A0A085LSX8 | 67-133 | None |
| A0A0C9YIM1 | 42-104 | None |
| A0A183GWF5 | 3-64 | None |
| A0A183DBW7 | 5-66 | None |
| H5VA20 | 1-57 | None |
| A0A3N4ZJ43 | 23-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.