DPCstruct | MC60489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 105 ± 20 aa |
| Standard deviation of domain lengths | 20.49 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.96 |
| Pfam Score | 99.17 |
| Assigned Pfam label(s) | CL0172- PF00631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9Y3X3 | 15-122 | TFVFPPPLSSTTVVIEFCDRCRWLHRASWIQTELFLTFPPPVIGTISLIPLNTDETAGRFRLWLSILDSQAPLLVWDRKVEGGFPEL… |
| A0A6M1QEY2 | 1-67 | MRPKIEIEYCPKCGWMLRAAYMAQELLTTFTEDVYGITLVPSEVNGRYQVRVEQSIIFDRKREGRFP |
| A0A066VEQ1 | 30-172 | None |
| A0A4Y3KFE7 | 1-76 | None |
| K3XA05 | 34-147 | None |
| A9TBY3 | 207-301 | None |
| A0A7R9WN94 | 76-157 | None |
| A0A6V7QXS8 | 81-200 | None |
| A0A4S9IAY2 | 5-113 | None |
| A0A395IGM5 | 1-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.