DPCstruct | MC60487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 119 ± 20 aa |
| Standard deviation of domain lengths | 20.24 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.02 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0036- PF01668 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G0VQL1 | 63-194 | IFNRKARHKYQILEKVESGIVLTGAEIKSIRAGRVDLSESFARVKEDEVFLVNAHILPWKGSEKFSDARRQRKLLLHRRQILNWQGK… |
| A0A0G2A9H6 | 134-256 | PAYAENRKARFDYEILETYEAGIELLGFEVKAIRSGRIMLTGAFAIPRGPELWLTTASIPAYQPENTPRGYDHERARRLLLHKSEIA… |
| F9EHW0 | 1-117 | None |
| A0A554JCN5 | 3-95 | None |
| J7GSK5 | 3-97 | None |
| A7K148 | 185-318 | None |
| A0A0G1XV70 | 3-137 | None |
| B7GAQ8 | 2-99 | None |
| A0A2J0MQY5 | 3-182 | None |
| A0A4V2N7P1 | 11-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.