DPCstruct | MC6048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 102 ± 15 aa |
| Standard deviation of domain lengths | 15.22 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.37 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | PF11225- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D0NHJ8 | 24-135 | KQALAKARYYAMEYVEENRPPLHLRDKVDLGFSLDNRELRIFEIRPVYNDPEIKIESDVARAKYIKSRDIWKVYWKRANGNWEPYRP… |
| A0A7Y0GER5 | 7-114 | EKKAQKALDVFLRNHRPPPHIRPQLHLGGRMNGQSKELFGIRPRLGKPENKLELPVAKATYVKTRVLWNVYRQRAELKWHRYDPAPQ… |
| W6KBC7 | 175-292 | None |
| A0A0G1E5K0 | 6-101 | None |
| U2RJM9 | 1-89 | None |
| A0A2R9STD0 | 1-63 | None |
| A0A5Q2NV36 | 36-146 | None |
| A0A454CX13 | 3-93 | None |
| A0A6J6E3L7 | 7-99 | None |
| A0A166D0V3 | 12-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.