DPCstruct | MC60473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 90 ± 4 aa |
| Standard deviation of domain lengths | 3.66 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661SMF1 | 1-92 | MFSDLKDLLDWHFDRMSDAEREIMHWLAVNREPVSYPELKEDILSPLSRKELPSALHFLLRGLPIEKRGKCFTIQPVLMEHMTDRLI… |
| A0A1T4ZJ56 | 118-205 | IFNGIKAILDQQFNHLSDLEQKIMYWLTIEGQSVSVKQLIENVFPPVSEALLLETLESLQRRSLIEKENLGFTQTHLIRAYITEKIIE |
| A0A841VT86 | 52-142 | None |
| E0UL31 | 399-491 | None |
| A0A844MB21 | 321-418 | None |
| A0A2T1DKG9 | 512-600 | None |
| A0A5P8W7G1 | 192-281 | None |
| A0A846D3C0 | 1-89 | None |
| A0A6M0G9H3 | 72-159 | None |
| A0A6H1TZ87 | 57-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.