DPCstruct | MC60471
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 18 aa |
| Standard deviation of domain lengths | 17.65 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 43.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E6NIQ7 | 47-131 | KKKKVRTSKVGDKVKTPSPSNKDFVKLHGTQGYQNKYTGEIWKKSNTNHSGSVGGEWKVGLGKGNIPTKSNKITVSGTGIILKII |
| A0A661SDH9 | 1-102 | MKIPVKPKTTGSGMLIVLSNKKAENCEIGEKVRTPDTYPIDFVKLKRGQGYKNKHTGEIWVKSHTSHRGDKWKVGRSGKPPTKGNKI… |
| A0A5E6NRG9 | 115-192 | None |
| A0A5E6ND88 | 376-456 | None |
| F4H9K2 | 267-356 | None |
| A0A838VF46 | 44-162 | None |
| A0A2V4EVF9 | 160-287 | None |
| A0A4Q1ANE4 | 106-228 | None |
| A0A198X8B1 | 104-203 | None |
| U1R297 | 1-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.