DPCstruct | MC6047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 266 ± 36 aa |
| Standard deviation of domain lengths | 35.52 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y4TQB9 | 25-300 | QLLKLCKKYFPGNYVVLKEYDESLINGMANGNSLNEYVYDIPTVVHEGYHSYTSNHSSYYDSLIVFRINDTLSFSVKKIKTFPSIQV… |
| A0A7Y0BIP0 | 4-245 | LLLAVDPAHGYAEFARLPGTFMWWLRSGSTSVDMLSLGAAVHETNHKIDSALRNLCTADGLARFFAEGQVYVTDISRNDKLANYSIA… |
| A0A7W0VUZ5 | 42-336 | None |
| A0A1F3Y3Z4 | 19-289 | None |
| A0A3M2DR79 | 30-309 | None |
| A0A4Q6BBI1 | 112-367 | None |
| A0A7J3CTK8 | 419-720 | None |
| A0A5C9E135 | 110-395 | None |
| A0A7Y7TUN3 | 335-670 | None |
| A0A368KC85 | 6-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.