DPCstruct | MC60469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 96 ± 8 aa |
| Standard deviation of domain lengths | 8.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0441 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661S5R9 | 1-107 | MIDFIRSKNFAGGFRPEIEISKIDINNNEIDIIVIFDRPYKPYYLDSDFQGLKANHIYTRTNDSNTPKNKSADLYVVEKMWRQRSAD… |
| E2NWN4 | 9-96 | VDFLKDKKFAGDIRPTVCVETIEIDNKLIDVIKVSNSLNTPFYLKERFQQINPNNIYARIQDTNTPVNRSADINIVELLWKKRFGLLL |
| W8QQL6 | 29-109 | None |
| A0A059XQM7 | 115-210 | None |
| A0A1T5FR81 | 1-102 | None |
| A0A6N7W050 | 40-140 | None |
| A0A3E4QWS0 | 92-188 | None |
| A0A7U9RAT8 | 54-138 | None |
| A0A4R3YG72 | 38-137 | None |
| A0A844J963 | 38-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.