DPCstruct | MC60466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 85 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661RWM5 | 1-92 | MSISLGPFIITPYLVDHSAYDAYAIQIEADGKKLFYSGDFRGHGRKRKLLDRLVAHPPVKIDTLLMEGTTLSRGSDVIQTINGHRFR… |
| A0A6G3UZG4 | 57-156 | GERTTHGPFDCEYFAVNHSIPDAIAVAIRTPAGVVLHTGDIKLDQLPLDNRLTDLAGFSRLGDEGVDLFLVDSTNAEVPGFVTPERE… |
| A0A7T9QBV7 | 212-307 | None |
| A0A0D2MKH4 | 2-77 | None |
| A0A3M8DMQ8 | 86-163 | None |
| A0A455V5J6 | 14-94 | None |
| A0A7W1MYJ4 | 66-143 | None |
| X1DUM4 | 158-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.