DPCstruct | MC60463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 452 ± 61 aa |
| Standard deviation of domain lengths | 60.89 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.26 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0680- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182TBW3 | 55-515 | VFDLFTPFSVGLIYLAYRCFREISICKPNSSRPANSERYLVCKWKLPKTDLIQRHLQDVNSQMFNCSKKNIDTLELVSEEVLREDAT… |
| K1RSM4 | 308-795 | DKGVYFVMADGGFSVEGQENIQEILSKQLYLCQFLVAISILRPGGHFVCKLFDLFTPFSVGLVYLMYRIFDKVSICKPVTSRPANSE… |
| A0A7J6YU34 | 848-1218 | None |
| A0A085LVS2 | 369-782 | None |
| A0A484AYU8 | 520-1027 | None |
| A0A653C6X2 | 301-700 | None |
| A0A834NIR3 | 537-1021 | None |
| A0A6L5D8M4 | 1-456 | None |
| A0A8B6CYU9 | 625-1110 | None |
| A0A0X3NXS6 | 103-624 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.