DPCstruct | MC60461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 133 |
|---|---|
| Mean domain length (aa) | 115 ± 33 aa |
| Standard deviation of domain lengths | 32.86 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.13 |
| Pfam Score | 82.53 |
| Assigned Pfam label(s) | CL0137- PF04032- PF15719 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A842UW59 | 131-226 | EIARQRIRELFDQAKKMFSTDPKLSDRYVRLAKKLSMKYKVRIPQELRRRMCKHCLAYLVPDKTSQTRTKEGKVVIHCLRCGGIMRV… |
| A0A182T9B8 | 3-96 | FLYQAAALMSETNPQLSATYGKLAKSIGKKAVLRMEPAIKRTLCVRCGVLLNPATTADIQDHRHKQLCYVQVNCKLCGYRKRFYNSK… |
| A0A1Y1UUL7 | 101-207 | None |
| A0A0B6YVT4 | 2-70 | None |
| A0A7M7GJI9 | 10-192 | None |
| A0A7C6EI65 | 11-104 | None |
| A0A1M3T2N8 | 4-195 | None |
| A0A2H3C1G7 | 1-95 | None |
| A0A7G7JNH9 | 7-132 | None |
| A0A2H6KC46 | 15-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.