DPCstruct | MC60460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 368 ± 38 aa |
| Standard deviation of domain lengths | 37.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 20.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0J6A6 | 18-362 | LRSMQGHDLNSYAYALLNNFNVEINRHRFIVSYDAQKSSAKAIRFYASYRNNEESRLRNADKNNNDNANNSPLEARASSAIPSTPSK… |
| A0A7S5HGD6 | 696-1068 | NKNKFEKVYGEEKTGFAFRCQYKGDQQSFQFADFYNFAKRNDFFSAAFFPWAEKTIQYNNFDVYYDPARSAAKSAKFALNYANKYAN… |
| Q16927 | 1343-1762 | None |
| A0A1I8B9T8 | 4-303 | None |
| A0A7R9FBL3 | 271-654 | None |
| Q9U8M0 | 1109-1496 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.